PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc04544.1.g00060.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family CO-like
Protein Properties Length: 774aa    MW: 84630.1 Da    PI: 9.7743
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc04544.1.g00060.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box16.22.2e-053483791338
                      zf-B_box  13 elqlfCedCqqllCedClleeHkg......Ht 38 
                                   +++++C  ++ +lC+ C  + H+       H+
  Zmw_sc04544.1.g00060.1.am.mk 348 RARWYCAADDAFLCQACDASVHSAnplarrHE 379
                                   589*******************6566766776 PP

2CCT66.29.2e-23713756144
                           CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                                   Rea+++RY+eKr+tR+F KkirYe+RK +Ae+RpR+KGrFvk++
  Zmw_sc04544.1.g00060.1.am.mk 713 REARVSRYREKRRTRLFAKKIRYEVRKLNAEKRPRMKGRFVKRP 756
                                   9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.006336383IPR000315B-box-type zinc finger
PROSITE profilePS501198.702336383IPR000315B-box-type zinc finger
CDDcd000211.96E-6348383No hitNo description
PROSITE profilePS5101715.993713755IPR010402CCT domain
PfamPF062031.0E-17713755IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 774 aa     Download sequence    Send to blast
MPTAQRTGAP PCSAGSLLPS PTRASPRLAI PRPQGVRREL LLPSNPINRR GRARASPGLS  60
EHLPDAGWLG LGTALRSTLV GRTAHCGAAA AVRRSPAKWQ VNARIHQSGR LIGPAKMGAC  120
GAGQEGAAWD EEEGKRHRSA PSLPRRGEGG NAWSERDAAV GLDFGIVGFE KTQREGERTH  180
VFGQGHEKSL LQAPVQRINT TAQPSLAYYN TDTGRALRPV TSPRQRWRHR IRPTPGCGTG  240
YTPGWEGARR IVVMCFLEGW TKGWARHPSR GPRKNPGLSN GISQNWIRYF QRANCVSDKA  300
CAWALTSTLK VESTLVTAAE VSRKEHLLGQ AALIRPRARA TAAXXXXRAR WYCAADDAFL  360
CQACDASVHS ANPLARRHER LRLRPTSPPP HESSLDQTIA ARSTSTQRRP VAPAWSRRKA  420
RSRRPQVKSV GQLLSRKLVV PELAAESSEE RKAEEDGSEE TQLLCHRVPS FDRALAELCS  480
PLPVDDAAAA ASSSRDNIDA AVEDASKQDS QLPDSLSSFG PTDAELREFA ADMEALLGQG  540
MDDSNELDES FYMESLGLMT PVEDDGGRVK MEPHGDISNC DGAFGIGRHT DMKSVASAEV  600
LDIDSKIPNC CSPTAVDDED YEDSFEQKAP MASNGDAPDA QFLRRSLDLR LNYEAIIESW  660
GTTPWTDGQR PCVRLDDFWP HHAYHSGAWT PGGGQPPGFG PLTPPRWGTD GCREARVSRY  720
REKRRTRLFA KKIRYEVRKL NAEKRPRMKG RFVKRPAAGA GGGAAVTPAS RRPS
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1723739RRTRLFAKKIRYEVRKL
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014661075.11e-168PREDICTED: zinc finger protein CONSTANS-LIKE 16-like isoform X1
TrEMBLK3YS801e-168K3YS80_SETIT; Uncharacterized protein
STRINGSi017124m1e-168(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32833058